| license | tags | ||
|---|---|---|---|
cc-by-nc-4.0 |
|
LC-PLM is a frontier long-context protein language model based on an alternative protein LM architecture, BiMamba-S, built off selective structured state-space models. It is pretrained on UniRef50/90 with masked language modeling (MLM) objective. For detailed information on the model architecture, training data, and evaluation performance, please refer to the accompanying paper.
You can use LC-PLM to extract embeddings for amino acid residues and protein sequences. It can also be fine-tuned to predict residue- or protein- level properties.
pip install transformers mamba-ssm==2.2.2We use Git Large File Storage (LFS) to version the model weights. You can obtain the pretrained model and its related files simply by cloning this repo:
git clone https://github.com/amazon-science/LC-PLM.gitimport torch
from transformers import AutoTokenizer, AutoModelForMaskedLM
# Load the model and tokenizer
model = AutoModelForMaskedLM.from_pretrained("./LC-PLM", trust_remote_code=True)
tokenizer = AutoTokenizer.from_pretrained("facebook/esm2_t6_8M_UR50D")
# Input a protein sequence:
# fun fact: this is [Mambalgin-1](https://www.uniprot.org/uniprotkb/P0DKR6/entry) from Black mamba
sequence = "MKTLLLTLLVVTIVCLDLGYSLKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK"
# Tokenize the sequence:
inputs = tokenizer(sequence, return_tensors="pt")
# Inference with LC-PLM on GPU
device = torch.device("cuda:0")
model = model.to(device)
inputs = {key: val.to(device) for key, val in inputs.items()}
with torch.no_grad():
outputs = model(**inputs, output_hidden_states=True)
# Retrieve the embeddings
last_hidden_state = outputs.hidden_states[-1]
print(last_hidden_state.shape) # [batch_size, sequence_length, hidden_dim]@misc{wang2024longcontextproteinlanguagemodel,
title={Long-context Protein Language Model},
author={Yingheng Wang and Zichen Wang and Gil Sadeh and Luca Zancato and Alessandro Achille and George Karypis and Huzefa Rangwala},
year={2024},
eprint={2411.08909},
archivePrefix={arXiv},
primaryClass={q-bio.BM},
url={https://arxiv.org/abs/2411.08909},
}
See CONTRIBUTING for more information.
This project is licensed under the CC-BY-NC-4.0 License.